PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P00550_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 280aa    MW: 31694.6 Da    PI: 5.1402
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P00550_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.3e-1895147456
                            -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            + +++ eq+++Le+ Fe  +++   ++ eLA+ lgL+ rqV +WFqNrRa++k
  GSMUA_Achr4P00550_001  95 KKRLNLEQVRVLEKNFEIGNKLEPGRKMELARALGLQPRQVAIWFQNRRARWK 147
                            4568889*********************************************9 PP

2HD-ZIP_I/II1253.5e-4093183191
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekk+rl+ eqv++LE++Fe  +kLep rK+elar+Lglqprqva+WFqnrRAR+ktkqlEkdy++Lkr+++a+k+ene+L++++++L 
  GSMUA_Achr4P00550_001  93 EKKKRLNLEQVRVLEKNFEIGNKLEPGRKMELARALGLQPRQVAIWFQNRRARWKTKQLEKDYDVLKRQLEAMKTENEALQAQNKKLL 180
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eel 91 
                            +e+
  GSMUA_Achr4P00550_001 181 SEV 183
                            887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.91E-1987151IPR009057Homeodomain-like
PROSITE profilePS5007116.61789149IPR001356Homeobox domain
SMARTSM003895.4E-1792153IPR001356Homeobox domain
CDDcd000861.98E-1594150No hitNo description
PfamPF000464.2E-1595147IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.6E-19101148IPR009057Homeodomain-like
PRINTSPR000313.0E-6120129IPR000047Helix-turn-helix motif
PROSITE patternPS000270124147IPR017970Homeobox, conserved site
PRINTSPR000313.0E-6129145IPR000047Helix-turn-helix motif
PfamPF021834.3E-13149190IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MTCNGMPPLF PANLLLQIPH DETSPPGFGG ERPYLASYPQ DLTLGLLSND CVGAASVETL  60
LGKRSVSFSR MEACEELNIE EDLSDDGSQP AGEKKKRLNL EQVRVLEKNF EIGNKLEPGR  120
KMELARALGL QPRQVAIWFQ NRRARWKTKQ LEKDYDVLKR QLEAMKTENE ALQAQNKKLL  180
SEVLALKGKE TSEPINLNKE TEGSCSFRSD NSSDINLDLS TSDPHKSRVF FPSYRPPPAK  240
TETPKEEHSS IQEESFCTMF CSTDDQSAFW AWSEQHNFHQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141149RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009395119.10.0PREDICTED: homeobox-leucine zipper protein ATHB-13-like
SwissprotQ8LC032e-86ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLM0SJX20.0M0SJX2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P00550_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.18e-78HD-ZIP family protein